Vector and Tensor Analysis by Eutiquio C. Young PDF

By Eutiquio C. Young

ISBN-10: 0824787897

ISBN-13: 9780824787899

Revised and up to date all through, this e-book offers the elemental options of vector and tensor research with their corresponding actual and geometric functions - emphasizing the advance of computational abilities and uncomplicated approaches, and exploring hugely advanced and technical subject matters in simplified settings.;This textual content: accommodates transformation of oblong cartesian coordinate platforms and the invariance of the gradient, divergence and the curl into the dialogue of tensors; combines the try for independence of direction and the trail independence sections; bargains new examples and figures that exhibit computational equipment, in addition to carify suggestions; introduces subtitles in each one part to focus on the looks of recent subject matters; presents definitions and theorems in boldface sort for simple identity. It additionally includes numerical routines of various degrees of trouble and plenty of difficulties solved.

Show description

Read Online or Download Vector and Tensor Analysis PDF

Best analysis books

Risk-Based Reliability Analysis and Generic Principles for by Michael T. Todinov PDF

For a very long time, traditional reliability analyses were orientated in the direction of picking out the extra trustworthy procedure and preoccupied with maximising the reliability of engineering structures. at the foundation of counterexamples besides the fact that, we exhibit that opting for the extra trustworthy process doesn't unavoidably suggest picking the process with the smaller losses from mess ups!

Download e-book for kindle: Analysis and Topology in Nonlinear Differential Equations: A by Djairo G de Figueiredo, João Marcos do Ó, Carlos Tomei

This quantity is a suite of articles offered on the Workshop for Nonlinear research held in João Pessoa, Brazil, in September 2012. The impression of Bernhard Ruf, to whom this quantity is devoted at the celebration of his sixtieth birthday, is perceptible through the assortment by way of the alternative of issues and strategies.

Additional info for Vector and Tensor Analysis

Example text

1). These last three constructs all contain a deletion of the amino acid residue Ile91, located at the contact interface of the two TM helices (Fig. 2). 1 ), indicating that Ile91 is probably not specifically Table 1. Dimerisation capacity of GpA C-terminal mutants Mutant Sequence Dimer (%) Wt 72EITLIIFGVMAGVIGTILLISYGIRRLIKK1OI 72EITLIIFGVMAGVIGTI---GIRRLIKK1OI 72EITLIIFGVMAGVIGTI --SYGIRRLIKK10l 72EITLIIFGVMAGVIGTILL--GIRRLIKKIOI 72EITLIIFGVMAGVIGTILL-SYGIRRLIKKIOI 72EITLIIFGVMAGVIGTILLLLLGIRRLIKKI01 72EITLIIFGVMAGVIGTILLLLLLLRRLIKK10l 72EITLIIFGVMAGVI GTI --SYGI - LIKK101 72EITLIIFG VMAGVI GTI --SYG ILLLIKK 101 72EITLIIFGVMAGVI GTI --SYG ILLLILL 101 72EITLIIFGVMAGVIGTILL-SYGI - LIKK10l 72EITLIIFGVMAGVIGTILL-SYGILLLIKK1OI 72EITLIIFGVMAGVIGTILLISYGI - LIKK10l 72EITLIIFGVMAGVIGTILLISYGILLLIKK1OI 72EITLIIFGVMAGVIGTILLISYGILLLILL1Ol 84 0 0 9 86 78 77 2 2 73 0 45 69 74 55 1189/93 1189/91 1191/93 1191 91-93L 91-95L 1189/91,1196/97 1189/91,96/97L 1189/91,96/97L,1001101L 1191,1196/97 1191,96/97L 1196/97 96/97L 96/97L,1001101L 6 Mar Orzaez et al.

The hydrocarbon core (He) is the hydrophobic part of the membrane that is approximately 30 A thick. The polar heads of the phospholipids define the lipid/water interphases (IF) and add 15 Ato the thickness of each leaflet. It is this complex environment, with physical and chemical properties different from aqueous media, into which membrane proteins are integrated. All membrane protein structures solved to date show that TM domains fold as either a-helices or ~-strands, due to the physical and chemical constraints imposed by the hydrophobic environment (White and Wimley, 1999).

2001). Proline-induced hinges in transmembrane helices: possible roles in ion channel gating. Proteins 44(2), 63-72 Tomita, M. & Marchesi, V. T. (1975). Amino-acid sequence and oligosaccharide attachment sites of human erythrocyte glycophorin. Proc Natl Acad Sci USA 72(8),2964-8 Ulmschneider, M. B. & Sansom, M. S. (2001). Amino acid distributions in integral membrane protein structures. Biochim Biophys Acta 2( 1), 1-14 von Heijne, G. (1992). ] Mol Bioi 225(2), 487 -494 Wallin, E. & von Heijne, G.

Download PDF sample

Vector and Tensor Analysis by Eutiquio C. Young


by Ronald
4.4

Rated 4.76 of 5 – based on 37 votes